No products in the cart.
Sale
Exendin-4 Acetate – Purity 99.91% | GMP Factory
Original price was: $46.00.$43.00Current price is: $43.00.
Exendin-4 is a glucagon-like peptide-1 (GLP-1) receptor agonist widely used in laboratory research related to glucose metabolism and incretin signaling. Exendin-4 Acetate is commonly applied as a reference peptide in metabolic and endocrine studies.
Description
Product Description
Exendin-4 is a 39-amino-acid peptide originally isolated from the venom of Heloderma suspectum and identified as a potent agonist of the glucagon-like peptide-1 receptor (GLP-1R). Due to its structural stability and resistance to enzymatic degradation, Exendin-4 has become an important experimental tool in studies of incretin biology and metabolic regulation.
In laboratory research, Exendin-4 is widely used to investigate GLP-1 receptor–mediated signaling pathways involved in insulin secretion, glucose homeostasis, and pancreatic beta-cell function. Compared with native GLP-1, Exendin-4 exhibits prolonged receptor activation, making it particularly suitable for receptor binding, signaling, and functional assays.
Exendin-4 Acetate is supplied as a trifluoroacetate- or acetate-based peptide salt, supporting solubility, stability, and reproducibility under controlled experimental conditions.
Product Specifications
| Item | Description |
|---|---|
| Product Name | Exendin-4 Acetate |
| Synonyms | Exendin-4; Exenatide (research grade) |
| CAS Number | 141732-76-5 |
| Molecular Formula | C₁₈₄H₂₈₂N₅₀O₆₀ |
| Molecular Weight | ~4186.6 g/mol |
| Amino Acid Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Peptide Type | Linear peptide |
| Form | Lyophilized powder |
| Purity | ≥98% (HPLC) |
| Strength Options | 0.1 mg / 0.5 mg / 1 mg |
| Appearance | White to off-white powder |
| Identity Verification | HPLC, Mass Spectrometry |
| Solubility | Soluble in water or buffered aqueous solutions |
| Packaging | Sterile glass vial |
| Storage Condition | −20 °C, protected from light and moisture |
| Intended Use | For laboratory research use only |
Applications
Exendin-4 is commonly used in laboratory research applications such as:
GLP-1 receptor activation and signaling studies
Glucose metabolism and insulin secretion research
Incretin hormone pathway investigations
Pancreatic beta-cell function assays
Pharmacological evaluation of GLP-1 receptor modulators
Exendin-4 Acetate Chemical structure
Storage & Stability
Lyophilized Exendin-4 Acetate should be stored at −20 °C in a dry, light-protected environment. After reconstitution, Exendin-4 solutions should be aliquoted and frozen to avoid repeated freeze–thaw cycles that may affect peptide stability.
Disclaimer
This product is intended for laboratory research use only. It is not intended for human or veterinary use and should not be used for diagnostic, therapeutic, or clinical purposes. The information provided on this page is for scientific reference only and does not constitute medical advice.
Additional information
| Weight | 0.8 kg |
|---|---|
| Dimensions | 26 × 23 × 26 cm |
1. What is Exendin-4 mainly used for in research?
Exendin-4 is primarily used to study GLP-1 receptor signaling, insulin secretion, and metabolic regulation.
2. Is Exendin-4 the same as GLP-1?
No. Exendin-4 is a distinct peptide that acts as a GLP-1 receptor agonist but has greater stability than native GLP-1.
3. Why is Exendin-4 supplied as an acetate salt?
The acetate salt form supports peptide stability and consistent solubility in laboratory applications.
4. What concentration range is typically used in vitro?
Exendin-4 is commonly used in the nanomolar range, depending on the experimental design.
5. Can Exendin-4 be used for receptor binding assays?
Yes. Exendin-4 is frequently used as a reference agonist in GLP-1 receptor binding and signaling studies.
6. How should Exendin-4 be reconstituted?
It may be reconstituted in sterile water or buffered aqueous solutions under controlled conditions.
7. How should reconstituted Exendin-4 be stored?
Aliquoted solutions should be stored at −20 °C and protected from light.
8. Is Exendin-4 suitable for long-term experiments?
Yes. Its enhanced stability allows for prolonged receptor activation in experimental systems.
9. Is Exendin-4 species-specific?
No. Exendin-4 activates GLP-1 receptors across multiple mammalian species.
10. Is this product intended for clinical use?
No. Exendin-4 Acetate is intended for laboratory research use only.
Related products
Top Quality Peptides Lyophilized Powder – Reta Trutide Fitness and Weight Loss Peptide in Stock | Factory Wholesale
Peptides Function Weight Loss Peptides Moq:10 vials per box Original price was: $38.00.$22.00Current price is: $22.00.Factory Supply Peptide Healthcare 99% with Safe Delivery
Peptide Healthcare Usage Delta-Sleep Inducing Peptides Purity 99%Over Dose 2mg 5mg 10mg 15mg 20mg Highe Original price was: $28.00.$23.00Current price is: $23.00.Anti-Aging Peptide Raw Powder CAS 307297-39-8 Epitalon – Low Price Wholesale
Anti-Aging Moq:10 vials per box Appearance:Lyophilized powder Purity:99% Original price was: $29.00.$23.00Current price is: $23.00.Best Price with Peptides 10mg Vials – High-Purity Weight Loss Peptide in Stock with Safe Delivery
Weight Loss Peptide Moq: 10 vials per box Package: plastic or paper box Purity:99% Original price was: $36.00.$24.00Current price is: $24.00.
Reviews
There are no reviews yet.