描述
Exendin(9?39) amide (also known as Avexitide) is a truncated 31-residue analogue of exendin?4, acting as a selective, competitive antagonist of the GLP?1 receptor. In human studies, it dose-dependently blocks GLP?1–induced insulin release and glucagon suppression while exhibiting no agonistic activity. Purity ?99.78% by HPLC, verified with batch-specific Certificate of Analysis (COA). The peptide is synthesized in certified research-grade facilities and supplied as white to off-white lyophilized powder.
?? Strictly for laboratory research use only—not approved for therapeutic, diagnostic, or clinical application.
Product Specifications
Parameter | Specification |
---|---|
Product Name | Exendin(9?39) amide (Avexitide) |
Synonyms | Exendin?3(9?39) amide, Avexitide, GLP?1 antagonist |
CAS Number | 133514?43?9 |
Purity (HPLC) | ?99.78% |
Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS?NH? |
Molecular Formula | C???H???N??O??S |
Molecular Weight | ~3,369.8 Da |
Appearance | White to off?white lyophilized powder |
Solubility | Soluble in water up to ~1?mg/mL |
Source | Synthetic peptide (non-animal derived) |
Manufacture | Certified research-grade peptide facility |
Storage | Store at ?20?°C or colder; protect from light and moisture |
Packaging | 1?mg, 5?mg, 10?mg vials or bulk quantities |
Intended Use | For laboratory research use only; not for human or veterinary use |
Mechanism of Action & Research Applications
Exendin(9?39) amide acts as a specific GLP?1 receptor antagonist, blocking GLP?1–induced cAMP signaling and insulin release even in supraphysiological conditions. It is widely employed in studies investigating incretin physiology, ?-cell function, diabetes modeling, and GLP?1 receptor pharmacology.
Ideal for:
-
GLP?1 receptor antagonist assays
-
In vitro and in vivo insulin/glucagon regulation studies
-
Therapeutic diabetes and metabolic research models
-
Dissecting incretin signaling pathways in cell/tissue systems
Side Effects (For Laboratory Reference Only)
In human or animal studies, Exendin(9?39) amide has been shown to:
-
Increase fasting glucagon levels during euglycemia and hyperglycemia
-
Reduce GLP?1?mediated insulin release under glucose challenge
-
Display no intrinsic agonist activity
Use proper dose titration and ethical controls in in vivo protocols.
Disclaimer
This product is provided exclusively for laboratory research use. It is not authorized for clinical, therapeutic, or diagnostic use in humans or animals. Handling must follow institutional and safety guidelines.
评价
目前还没有评价