Insulin glulisine – Wholesale of 98% high-purity raw materials | GMP Manufacturer

Sale

Insulin glulisine – Wholesale of 98% high-purity raw materials | GMP Manufacturer

Original price was: $36.00.Current price is: $32.00.

Insulin glulisine is a rapid-acting insulin analog supplied as high-purity lyophilized powder for research use. It is widely studied in glucose metabolism, insulin receptor signaling, and pharmacokinetic modeling research.

EMI starting from $0.00/month - View Plans
Category:

Description

Product Description

Insulin glulisine is a recombinant human insulin analog engineered to exhibit rapid onset of action and altered pharmacokinetic properties compared with native human insulin. It differs from human insulin by specific amino acid substitutions in the B chain, resulting in reduced self-association and enhanced absorption characteristics in experimental models.

Supplied as a high-purity lyophilized powder, insulin glulisine is intended strictly for research and laboratory use. In scientific studies, it is commonly employed in investigations of insulin receptor activation, downstream signaling pathways, glucose uptake mechanisms, and comparative pharmacodynamic analyses among insulin analogs.


Product Specifications

ItemDescription
Product NameInsulin Glulisine
SynonymsInsulin Glulisine (Recombinant), Glulisine Insulin
CAS Number160337-95-1
Molecular FormulaC258H384N64O78S6
Molecular Weight~5823.6 g/mol
Amino Acid SequenceA Chain: GIVEQCCTSICSLYQLENYCN
B Chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Peptide TypeRecombinant insulin analog (two-chain peptide)
FormLyophilized powder
Purity≥98% (HPLC)
Strength Options5 mg / 10 mg / 20 mg
AppearanceWhite to off-white powder
Identity VerificationHPLC, Mass Spectrometry
SolubilitySoluble in water and suitable aqueous buffers
PackagingSterile, sealed research vials
Storage Condition−20 °C, dry and light-protected
Intended UseResearch use only (RUO)

Applications

Insulin glulisine is commonly used in the following research areas:

  • Insulin receptor activation and signaling pathway studies

  • Glucose uptake and metabolic regulation research

  • Comparative pharmacokinetic and pharmacodynamic modeling

  • Endocrine and diabetes-related experimental models

  • In vitro and in vivo insulin analog characterization studies


Usage & Reconstitution

Insulin glulisine lyophilized powder should be handled under sterile laboratory conditions. Reconstitution is typically performed using sterile water or appropriate buffered solutions to achieve desired experimental concentrations.

Aliquoting after reconstitution is recommended to avoid repeated freeze–thaw cycles. Solution stability and concentration should be optimized based on specific research models.


Storage & Stability

  • Store unopened vials at −20 °C

  • Protect from moisture and direct light

  • Avoid repeated freeze–thaw cycles

  • Properly stored aliquots maintain stability for extended research use


Shipping Guarantee

Insulin glulisine lyophilized powder is packaged according to standardized laboratory material handling procedures:

  • Moisture- and light-protected inner packaging

  • Secure outer containers to prevent transit damage

  • Batch-level labeling for traceability

  • Cold-chain handling applied when necessary


Contact & Bulk Inquiry

For inquiries regarding Insulin Glulisine high-purity lyophilized powder, including bulk supply, specifications, and research support, please contact our team through the inquiry form or designated communication channels.

Our team can assist with:

  • Bulk and wholesale supply options

  • Batch consistency and available specifications

  • Technical documentation requests (COA, HPLC, MS)

  • International shipping and logistics coordination


    Disclaimer

    This product is intended for research and laboratory use only.
    Not for human or veterinary use.
    All handling and experimental applications must comply with applicable regulations and institutional policies.

    Additional information

    Weight0.7 kg
    Dimensions28 × 23 × 28 cm

    Reviews

    There are no reviews yet.

    Be the first to review “Insulin glulisine – Wholesale of 98% high-purity raw materials | GMP Manufacturer”

    Your email address will not be published. Required fields are marked *

    1. What is insulin glulisine mainly used for in research?

    It is primarily used to study insulin signaling and glucose metabolism.

    2. How does insulin glulisine differ from human insulin?

    It contains specific amino acid substitutions that alter absorption and association properties.

    3. What purity level is provided?

    The product is supplied with ≥98% purity, verified by HPLC.

    4. How is product identity confirmed?

    Identity is confirmed using HPLC and mass spectrometry.

    5. How should insulin glulisine be reconstituted?

    It is typically reconstituted in sterile water or suitable aqueous buffers.

    6. What storage conditions are recommended?

    Store at −20 °C, protected from light and moisture.

    7. Can insulin glulisine be used in receptor-binding studies?

    Yes, it is widely used in insulin receptor and downstream signaling research.

    8. Is this product suitable for clinical or therapeutic use?

    No. It is intended strictly for research and laboratory use only.

    9. What factors should be considered in experimental design?

    Dose selection, model system, and solution stability should be carefully evaluated.

    10. Is bulk supply available for research institutions?

    Yes, multiple package sizes are available to support bulk research requirements.


    EMI Options