Description
Product Description
Insulin glulisine is a recombinant human insulin analog engineered to exhibit rapid onset of action and altered pharmacokinetic properties compared with native human insulin. It differs from human insulin by specific amino acid substitutions in the B chain, resulting in reduced self-association and enhanced absorption characteristics in experimental models.
Supplied as a high-purity lyophilized powder, insulin glulisine is intended strictly for research and laboratory use. In scientific studies, it is commonly employed in investigations of insulin receptor activation, downstream signaling pathways, glucose uptake mechanisms, and comparative pharmacodynamic analyses among insulin analogs.
Product Specifications
| Item | Description |
|---|---|
| Product Name | Insulin Glulisine |
| Synonyms | Insulin Glulisine (Recombinant), Glulisine Insulin |
| CAS Number | 160337-95-1 |
| Molecular Formula | C258H384N64O78S6 |
| Molecular Weight | ~5823.6 g/mol |
| Amino Acid Sequence | A Chain: GIVEQCCTSICSLYQLENYCN B Chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Peptide Type | Recombinant insulin analog (two-chain peptide) |
| Form | Lyophilized powder |
| Purity | ≥98% (HPLC) |
| Strength Options | 5 mg / 10 mg / 20 mg |
| Appearance | White to off-white powder |
| Identity Verification | HPLC, Mass Spectrometry |
| Solubility | Soluble in water and suitable aqueous buffers |
| Packaging | Sterile, sealed research vials |
| Storage Condition | −20 °C, dry and light-protected |
| Intended Use | Research use only (RUO) |
Applications
Insulin glulisine is commonly used in the following research areas:
Insulin receptor activation and signaling pathway studies
Glucose uptake and metabolic regulation research
Comparative pharmacokinetic and pharmacodynamic modeling
Endocrine and diabetes-related experimental models
In vitro and in vivo insulin analog characterization studies
Usage & Reconstitution
Insulin glulisine lyophilized powder should be handled under sterile laboratory conditions. Reconstitution is typically performed using sterile water or appropriate buffered solutions to achieve desired experimental concentrations.
Aliquoting after reconstitution is recommended to avoid repeated freeze–thaw cycles. Solution stability and concentration should be optimized based on specific research models.
Storage & Stability
Store unopened vials at −20 °C
Protect from moisture and direct light
Avoid repeated freeze–thaw cycles
Properly stored aliquots maintain stability for extended research use
Shipping Guarantee
Insulin glulisine lyophilized powder is packaged according to standardized laboratory material handling procedures:
Moisture- and light-protected inner packaging
Secure outer containers to prevent transit damage
Batch-level labeling for traceability
Cold-chain handling applied when necessary
Contact & Bulk Inquiry
For inquiries regarding Insulin Glulisine high-purity lyophilized powder, including bulk supply, specifications, and research support, please contact our team through the inquiry form or designated communication channels.
Our team can assist with:
Bulk and wholesale supply options
Batch consistency and available specifications
Technical documentation requests (COA, HPLC, MS)
International shipping and logistics coordination
Disclaimer
This product is intended for research and laboratory use only.
Not for human or veterinary use.
All handling and experimental applications must comply with applicable regulations and institutional policies.


Reviews
There are no reviews yet.