描述
Exendin is a 39-amino-acid peptide originally isolated from the venom of the Gila monster (Heloderma suspectum). It acts as a high-affinity GLP-1 receptor agonist, enhancing glucose-dependent insulin secretion, reducing glucagon levels, slowing gastric emptying, and promoting -cell regeneration.
This peptide is widely used in preclinical studies for Type 2 diabetes, obesity, and neuroendocrine research. Our Exendin?4 is synthesized in certified peptide manufacturing facilities, delivering 99.95% purity verified by HPLC and supported by full documentation, including Certificate of Analysis (COA) and batch traceability.
This product is intended strictly for laboratory research use only. It is not approved for therapeutic or clinical use.
Product Specifications
Parameter | Specification |
---|---|
Product Name | Exendin |
CAS Number | 141758-74-9 |
Molecular Formula | C???H???N??O??S |
Molecular Weight | ~4186.6 Da |
Purity (HPLC) | 99.95% |
Appearance | White to off-white lyophilized powder |
Synonyms | Exenatide, AC-2993 |
Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH? |
Solubility | Soluble in water or phosphate-buffered saline |
Source | Synthetic peptide (non-animal origin) |
Manufacture | Certified research-grade peptide facility |
Storage | ?20°C or below, protect from light and moisture |
Packaging | 1 mg, 5 mg, 10 mg vials or bulk quantities |
Intended Use | For laboratory research use only |
Mechanism of Action & Research Applications
Exendin?4 binds to and activates the GLP?1 receptor (GLP?1R), mimicking the action of endogenous GLP?1 but with increased stability and a prolonged half-life. It enhances cAMP signaling in pancreatic ??cells, promotes insulin secretion, suppresses glucagon, and contributes to glucose homeostasis.
Common research applications include:
-
Type 2 diabetes and insulin signaling models
-
Obesity and metabolic syndrome studies
-
GLP?1 receptor pharmacology
-
??cell proliferation and protection
-
Appetite regulation and CNS signaling
-
Hepatic steatosis and lipid metabolism studies
Its long-acting activity and receptor selectivity make Exendin?4 a valuable tool in metabolic and endocrinological research.
Side Effects (For Laboratory Reference Only)
In experimental models, Exendin?4 may exhibit the following effects:
-
Hypoglycemia (dose-dependent)
-
Gastrointestinal effects (e.g., delayed gastric emptying, nausea)
-
Weight loss in animal models
-
Changes in pancreatic or gut hormone expression
Proper controls and ethical oversight are recommended in in vivo studies.
Disclaimer
This product is supplied exclusively for laboratory research purposes. It is not for human or veterinary use, and is not approved for clinical, therapeutic, or diagnostic applications. Handle with standard lab safety protocols.
评价
目前还没有评价